PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00156289001
Common NameGSBRNA2T00156289001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family LBD
Protein Properties Length: 226aa    MW: 25006.8 Da    PI: 7.3897
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00156289001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260134.25e-42671661100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+C ++Cvlapyfp ++p+kf ++h++FGasn++kll++lpe++r+da++s+vyeA ar+rdP+yG++g i +lq+q+++l
  GSBRNA2T00156289001  67 PCAACKILRRRCGDKCVLAPYFPPTEPAKFTIAHRVFGASNIIKLLQELPESQRTDAVNSMVYEAGARIRDPIYGCAGAIYNLQRQVSEL 156
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la+++ e
  GSBRNA2T00156289001 157 QAQLAKAQVE 166
                          *****99865 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.97366167IPR004883Lateral organ boundaries, LOB
PfamPF031957.9E-4267164IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 226 aa     Download sequence    Send to blast
MASFMMSGGH LTLSIYTTYL PKSTSPSKHL IMLDMESKCD ASAAIISASP TSSPPPPQLS  60
PRLVLSPCAA CKILRRRCGD KCVLAPYFPP TEPAKFTIAH RVFGASNIIK LLQELPESQR  120
TDAVNSMVYE AGARIRDPIY GCAGAIYNLQ RQVSELQAQL AKAQVEIVSM QLQRSNLLEL  180
IHNMDQPNQE QHNMSFEKSN DFGFIEDNKY SNTIPSTLWC DPLWI*
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00156289001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009148039.11e-151PREDICTED: LOB domain-containing protein 1-like
RefseqXP_013646476.11e-151PREDICTED: LOB domain-containing protein 1-like
RefseqXP_013646477.11e-151PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR01e-100LBD1_ARATH; LOB domain-containing protein 1
TrEMBLA0A078DYV81e-169A0A078DYV8_BRANA; BnaA06g04390D protein
STRINGBra018675.1-P1e-123(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM114128105
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.11e-93LOB domain-containing protein 1
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]